GenomeNet

>tr:A0A150X663_9BACT [A0A150X663] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KYG74176.1};
MKNKENRSPLAIKFMGFLFVILLASSCIPNEKIVYMQNKEDEEALSNDQLIALSRVDYKL
QPNDILLINFYSRELGEVEKYYPIFARPDNLLRMGNQNGGGNNGNGNNNNDPYMTGYNVD
RDGKIEINSLGKVNAAGLTTTELKKQIEDLIRPDISDIGVSVKLSGIPFTIYGEVNNPGP
QLVRQYDLNLLEAIARAGDLTINANRNHVLIMRQYPDGVKIHEVDVTGRKFIESELFFIQ
PDDLIYVAPLKIRELGTGETALQTFATIVSVISGTVLVISVLSNN

BLAST