GenomeNet

>tr:A0A151MUT4_ALLMI [A0A151MUT4] SubName: Full=Ryanodine receptor 3 isoform D {ECO:0000313|EMBL:KYO28313.1};
MDDEVVLQCVANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVPPDLCICNFVLEQSLSV
RALQEMLANTGDNASEGAAQGGGHRTLLYGHAILLRHSFSGMYLTCLTTSRSQTDKLAFD
VGLRENAAGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLHLSMSNGNIQVDAS
FMQTLWNVHPTCSGSSITEGFLLGGHVVRFFHGHDECLTIPSMDQNDLQQKRVLYETGGA
GVRARSLWRVEPLRISWSGSNIRWGQPFRLRHITTGEYLALSEEEGLVMLDREKSDTTST
AFCFRASKELKEKQDSSHKRDIDGMGVPEIKYGDSICFVQHVASALWLTYKAQDAKTARL
GPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTSLFNQFISGNNRISAPIALPI
EEMLQTLQDLITYFQPPEEELEHEDKQNKLRSLKNRQNLFKEEGMLALVLNCIDRLNDYN
SAAHLVGVAREVNGTAWKEILNHLYKLLAALIRGNRNNCTQFSGNLDWLISKLDRLESSS
GILEVLHCILTESPEALNLIAEGHIKSIISLLDKHGRNYKVLDVLCSLCLCNGVAVRANQ
NLICDNLLPRRDLLLQTRLVNDVTSIRPNIFLGVAEGSAQYKKWYFELIIDQVDPFLTAE
PTHLRVGWASTSGYAPYPGGGEGWGGNGVGDDLFSYGFDGLHLWSGRVSRPVASVNQHLL
ASDDVVSCCLDLGVPSISFRINGQPVQGMFENFGTDGLFFPVVSFSAGVKVRFLLGGRHG
EFKFLPPAGYAPCYEALLPKEKMKLEPVKEYKRDFDGVRDLLGTTQFLSQASFIPCPIDT
SQIVLPLHLEKIRDKLAENIHELWGMNKIELGWTYGKVRDDNKRQHPCLVEFSKLPETEK
NYNLQMSTETLKTLLALGCHIVHSNLAAEEDLKKVKLPKNYMMSNGYKPAPLDLSEVKLL
PSQEVLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLVPYALLDERTKKSNRDS
LREAIRTFAGYGYNIEPPDQEIADQAMQKVSIDKIRFFRVEQSYAVKTGKWYFEFEAVTG
GDMRVGWARPGCRPDLELGADDQAFVFEGSKGQRWHQGSGFFGRNWQPGDVVGCMINLDD
KSMIFTLNGELLITNKGSELAFADFQLENGFVPICSLGLSQIGRMNLGMDASTFKYYTMC
GLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKNHPHIEITRIDGTIENPPRLKVTHRTF
GTQNSNADMIYCRLSMPIEFHSSFNYNTGAESASADAFQKRKQSQEIAVPSTYYYSVRIF
AGQDPSSVWVGWVTPDYHYYSENFDLNKNCTVTVTLGDERGRVHESVKRSNCYMVWGGDV
TAHSQRSGRSNVDLEIGCLVDLATGMLSFTANGKELGTCYQVEPNTKLFPAAFVQPTSTN
LVQFELCKLKNTMPLSAAIFKSEEKNPVPQCPPRLDVQTITPVLWSRMPNSFLKVETERV
SERHGWVVQCLEPLQMMALHIPEETRCVDILELCEQEDLMMFHYHTLKLYCSVCALGNSR
VAYALCSHVDISQLFYTIDNQYLPGLLRSGFYDLLISIHLEHAKQAKLMMNNEFIIPITD
ETRTIELYPDETKKHGLPGVGLSTCLKPGYYFSTPCFIVTSDEHLKSSPEISLDILKSKA
ISMLTEAVHCSGTHIRDPVGGQVEFQFVPVLKLIGTLLIMGVFDDDDVKQILLLIDPNVF
GEHKEETEEKTEKEEVTQIEEKAVEAGEKAIKETKAPIKGLLQTRLPESVKLQMCLLLNY
FCDCELQHRVESIVSFADNYVSKLQYNQRFRYNELMQALNMSAALTAKKTKEFRSPAQEQ
INMLLNFQLGEDCPCPEEIRDELYEFHDDLLIHCATLKQLISQTMVRWAQEDQMQDSELV
RIMYTLLRRQYDSIGELLQALRKAYTISAASVQDTINLLAALGQIRSLLSVRMGKEEELL
MINGLGDIMNNKVFYQHPNLMRVLGMHETVMDVMVNVLGGDKSQRIIFPKMVASCCRFLC
YFCRISRQNQKAMFEHLSYLLENSSVGLAFPSMRGSTPLDVAAASVMDNNELALALEEPD
LEKVVTYLAGCGLQSCPVLLAKGYPDIGWNPIEGERYLTFLRFAVFVNSESVEENASVVV
KLLIRRPECFGPDLRGEGGNGLLAAMQEAINISENPARDLPSQGYKREGAAEDEEEEEIV
HMGNAIMSFYSALIDLLGRCAPEMHLIQSGKGEAIRIRSILRSLVPTEDLVGIISIPLKL
STVNKDGTVNEPDMSASFCPDHKAPMVLFLDRVYGIKDQSFLLHLLEVGFLPDLRASASL
DTVSLSTTEAALALNRYICSAVFPLLKRCAPLFSGTEHYASLIDSTLHTIYRLSKGRSLT
KAQRDTIEECLLAVCHHLRPSMLQQLLRRLVFDVPLLNEYCKMPLKLLTNHYEQCWKYYC
LPSGMGSYGIAAEEELHLTEKLFWGIFDSLSHKFLSLLQKYDPELFRMALPCLSAIAGAL
PPDYLDTRIRATLEKQTSLDPEGNFDPKPINTVNLALPEKLEYIVSKYAEHSHDKWAFDK
TNSGWKYGVSLDENMKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAMGWRLERTKEGE
AMVQQRENEKLRSISQSSQGNGYSPAPLDLSNVVLSRELQGMVEVMAENYHNIWAKKKKM
ELESKGGGSHPLLVPYDTLTAKEKSRDREKAQELFKFLQVNGIVISRGLNDMELDASSME
KRFAFKFLKKILKYVDSAQEFIAHLEAIVTSGKTEKSPHDQEIKFFAKVLLPLVDQYFTN
HCLYFLSSPIKSLSSSGYASNKEKEMVASLFCKLAALVRHRISLFGSDATTVVSCLHILA
QSLDTRTVMKSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYT
TVALLPILTSMFEHIAQHHFGVDLLLGDVQVSCYRILCSLYSLGTGKNIYVERQCPALGE
CLASLAAAIPVAFLEPSLNRYNPLSVFNTKTARERAILGMPDTVEEMCPEIPHLDGLMRE
INGLAESGARYTEMPHVIEVILPMLCNYLSYWWEKGPESMPISAGPCCTMITSEHLSIIL
GNILKIINNNLGIDEASWMKRIAVYAQPIISKARPDLLKTHFIPTLEKLKKKAIKIVIEE
EQLRADSKTDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRANWLKKPDADSVELFR
MVAEVFILWCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKSGGQDQERKKSKRRGD
LYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKIRYSHRDTDEEVKEHLLNNLHLQE
KSEDPAVKWQLNLYKDIMKSDEPPDPEKTVERVQRISAALFHLEQVEQPLRSKKAVWHKL
LSKQRKRAVVACFRMAPLYNLPRHKISNFFLSTFQRVWLEKVHEKTQYDRLILMLTTPPR
KEEEEEEETEKKHPDPLHQIILYFSHNALTERSKLEDDALYISYSAMMAKEKEMEKQKTL
YQQARLHDRGAAEMVLQMISASKGKMGLMVIETLKLGIAILNGGNTIVQQKMLDYLKEKK
DAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTREKVLQYDEFTRDLFRFLQL
LCEGHNNDFQNYLRTQMGNTTTVNIIISTVDYLLRLQESISDFYWYYSGKDVIDDSGQRN
FSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQI
ELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKD
LTNSDAFKEYDPDGLFQLFFTIVWGIFQILWSTVFGGGLVEGAKNIKVTKILGDMPDPTQ
FGIHDDVMETEKAEGVEHGIRAELVQFVKGEKGETDIMSDIFGIRTKKEGGSKYSHDAGL
GDIKEIIGSDSPSSLENAVRKKKRAQTSEIAKEVEMEIKTESEKADMEDGEKQDKAKEIQ
SEHLEEGKMKKKKRRRGQKIEKPEAVMANFVKALEVYQTKMLHCLARNFYNLRFLALFVA
FAINFILLFYKVTEEPLDEVEEDSNLWNSFDEDEEEEGMVFFVLEESTGYMAPTLRGLAI
IHTVISFVCVIGYYCLKVPLVVFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINT
PSFPNNYWDKFVKRKVINKYGDLYGADRIAELLGLDKNALDFSPVEETEPDEASLVSWLS
SIDTKYHIWKLGVVFTDNSFLYLAWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSS
VTHNGKQLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKCDDMMTCYLFHMYV
GVRAGGGIGDEIEDPAGDPYEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQ
VREDMETKCFICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESF
VWKMYQERCWDFFPAGDCFRKQYEDQLG

BLAST