GenomeNet

>tr:A0A157RPP6_9BORD [A0A157RPP6] SubName: Full=Conjugal transfer protein TrbL {ECO:0000313|EMBL:SAI71618.1};
MRKKIALGGLMMVTTVVLAEPAMAQELSSSGVMNDVLKRFHDAAATWGPAIESAASRLFW
TLVVISMVWTFGMMALRKADIGEFFAEFVRFTIFTGFFWWLLTNANQGMNIAGTIVQSLQ
TLGAQAGGLSNSNLGPSSILDLGFELYNRTVQATSELGWRQMATALVMELMALAVLFVLA
LIAVNLLLLLASAWILLYAGVFFLGFGGSRWTSDMAINYYKTVLGLAAQLMAMVLLVAIG
KEFINHYYTQISENLASQELAVMLVISVILLFLVNKIPPMISGLVSGGGIGAAGGIGNFG
AGAAVGAAVTAASMATGGAALAGKAVMGAAAGAAGGASALQAAFQKASASMEAGGDMSSM
GSVVSSGGSGGDEAGTGDTPFAQAAGFGDSGSSSRGGGFARAAKLATGTASELAKGVGSQ
LKQGFQERVSETTSGKLAASIRESMEPKEAGQSGQFEGNSLGGDSGPDSNEVRR

BLAST