GenomeNet

>tr:A0A157SAU9_9BORD [A0A157SAU9] SubName: Full=Conjugal transfer protein TrbL {ECO:0000313|EMBL:SAI67567.1};
MNDVTVIDRFLDTFSRYIDSGFGLLQGEVAFLTATLIVIDMTLAGLYWALGHAAGQGEDA
IAKLLRKVLYVGAFAYIIGNFNWLAGIVFRSFAGLGLAAAGSAITMENFLQPGRLAKTGI
DAAAPILEQIGDMAGFPEVFANLDPIVVLFLAWLVVIVCFFVLAVQLFITLIEFKLTSLA
GFVLVPFALWNKTSFLAEKVLGNVVSSGIKVLVLAVIVGIGSSLFAQFQVHPAEPSIDHA
LVIMLASLALLALGIFGPGIATGLVSGAPQLGAGAMAGAAVGAAGTAVAIGAAATGVGGA
VMAGARMAPGAAKLAGSGVRAATSMAGSARSAFQAGSAAAGGEARGAMAGMGNVAKTGAQ
AAGRGVAFRASAAGQRMADSFRAGWNGLSDDGGAGAALPGAAAPGQAAAGEAAAGAATAQ
KQQPAWAKRLHRRQQIAQAATTAAHTLRGGDGGGSGAGPSLRDSDS

BLAST