GenomeNet

>tr:A0A158PAR0_ANGCA [A0A158PAR0] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:ACAC_0000989301-mRNA-1};
LIHSKFQIQWLLDNYETADGTSLPRCALYDHYKKHCHEHKLDAVNAASFGKLIRSVFNGL
RTRRLGTRGNSKYHYYGIRIKADSPLMQNHIPERYSPHEASEVLYCVKQLQFEHIEDKSL
GQTRLSQQQLFSLCTLPQIQHWVISLDLAFYQTLVDVLVPDVLMSNMSPFLTQSCRNFAK
NAEHYLKKAMQGAPEIIQKKKIQAVKYMAQGLRRYTSLNHLAQAARAVLQKPDQVMAMYN
DYIRVDMQQVQEQAGWVSGCDSLMVHHIHNAFKENLQKMAPMEEWAEWLESIVDQILAKY
HDKPVQIISEIGKQFLLNWSCYTSMLIRDLTLRSAGSFGSFHLIRLLTDEYMVYLVESRI
AKAVNRAMITVISQVNLLMTQQYIISSRQSEHTYDQKVCLNFLYS

BLAST