GenomeNet

>tr:A0A166MM05_9HOMO [A0A166MM05] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KZP24133.1};
MSAGPDDYERDPEKGSTEKALGYVPQARVEEAAPDQALVQRWGPLGRIMAKMFDVGVEAR
GVERVPEDQRETKNTWNNLLMWWSVNTVLTTIPIGVLAQEYYFLSFPHAIAVIFGFGALG
ASFTAFIATLGPQTGLRTMIITRFSSGYYGCTIYSCLNILTQLGFSVTAVILGGQTLASI
NPGTLPLVAGIVIVGLGSLIPCFIGYNMVHHYERFAWIIITVVMLMLWGLGGKAGFDINA
QKPLEDTGKTLTADVLSFGGIVFGSFTGWAPVAADYNCRLPVDTPPMKVFLLTWFGLFIP
IVFVEVLGAALMTITNEAYVDAFTDGGTGGLLSQVLSPWKGGGKFILFLLAFSVIGNNIP
NTYSAGLSIQALGRPFAKVPRFFWTFLCFVIYTVAGVIGREHFATILSNFLSILSYWTAF
FVVIVAEEHFLFRRPGGRLGGYNLEDYDTPSKLPLGIAGIFAGCCGVAGAVVGMAEVWYI
GPIGALAGAEFGADLGFELAAAFALVSYPPARWLEIHFTGR

BLAST