GenomeNet

>tr:A0A172TFS2_9BACL [A0A172TFS2] RecName: Full=AP_endonuc_2 domain-containing protein {ECO:0000259|Pfam:PF01261};
MLLTCKENMIQGLNMSEVCRKVKDAGFDGIDLMGGVLKQQLIEVKSALRDTGLVSAAVYG
QLGKAGSSLIDLTAAARVQALDLFKERIELAAEVGAGRLIFVPRFGKSELRPEASDWVLI
TMLDELAEWAAGIPVTLIMEPLNRRESEFLHDPLKGLALVSEVGRPNVKTMIDTYHMFVE
QQDVTDVTAQLGSALGLVHLSDSERKLPGQGVVDFQQVLHVLHKVRYDGPLGFECKEAGL
TELHTSVAYIKELLADVQAAARSKEKVQ

BLAST