GenomeNet

>tr:A0A176WLV2_MARPO [A0A176WLV2] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OAE34019.1};
MYQSVDGTACVRLLSLDGEVGCAGPDRRAVLAPLQHFSDANIQLSTKTTVVLPLSALHQF
LNRTVNERSLAKHVAGVLVEHGGADGQNLSRGFSPDTRFPQAEFAPYKAEYVWNPPGSGV
LQQRFEFPVFLLTPESTAAVRELTAGNEKRNFKYPLHVAEFDFVMQSTKSGTHDSESCLK
EWACLPLGGYSVWSSLPAINVTSPVENPIVLVMAAMDSASFFRDATPGADSPLSGLIAML
AAADALSRVPDVDEFQKQIVFLALTGEAWGYLGSRRFISELAGGNPALSGLSLSRIHQVL
EIGSVGKAVDAGRATLYVHKQKDQVSSATNEMVEALQLSATSLAGAQHVGAVEVKMASKL
NPGVPPSSLMSFIQKNSSTAAIVLEEFDEVFKNTLYHSHLDDANNIDKNSIAGTAALIAR
TVYLLGDSAANATQLQSIEVNSSLVSELVDCLLRQSPGMVCDLVKGLITPTQQYANHYVG
VLLGEPSFSPYLENVDDISRFVWNFLASRTGIVRNQQVKDGVAAGIKRASASSFEECAQK
CSNIDEICVGATGEHKGRCIMSTTRFVPAYSPRLQFEAASWKVVAAEPGDIMSEMDPVWT
ESFWKSISIWYFAVFRCLLNLPVPATSVVKEVEFWDAKNFSAHARALGFGFPVVGTRSSG
RRRDGDTRRVAALNSLGTNPERISSDRHDLGAMAARGALLRSFRRSTCQMTRTVASSSAT
TRSHLAQVLKHDVALPLAPSFSATDHLPYVGYPPAFRPRLFSSHAAGSSSNVVLVSDDAH
FQQSLKEVESSKSLGVVYFTAQWCGPCKQIAPYIDELSREFDDVTFLKIDVDNV

BLAST