GenomeNet

>tr:A0A178FVP9_9GAMM [A0A178FVP9] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MKTEVVEKKTDNLPMKKFISYVVLLVLVFFSAIMVVFQVFEYRHDYRELSAFNRERDDLN
AEWGRLLIEQQTFGATAQIGTRAVTQLRMYSPPAAQTVVISLPMTSEDKK

BLAST