GenomeNet

>tr:A0A180G3Z5_PUCT1 [A0A180G3Z5] RecName: Full=Arginine biosynthesis bifunctional protein ArgJ, mitochondrial {ECO:0000256|HAMAP-Rule:MF_03124}; Includes: RecName: Full=Glutamate N-acetyltransferase {ECO:0000256|HAMAP-Rule:MF_03124}; Short=GAT {ECO:0000256|HAMAP-Rule:MF_03124}; EC=2.3.1.35 {ECO:0000256|HAMAP-Rule:MF_03124}; AltName: Full=Ornithine acetyltransferase {ECO:0000256|HAMAP-Rule:MF_03124}; Short=OATase {ECO:0000256|HAMAP-Rule:MF_03124}; AltName: Full=Ornithine transacetylase {ECO:0000256|HAMAP-Rule:MF_03124}; Includes: RecName: Full=Amino-acid acetyltransferase {ECO:0000256|HAMAP-Rule:MF_03124}; EC=2.3.1.1 {ECO:0000256|HAMAP-Rule:MF_03124}; AltName: Full=N-acetylglutamate synthase {ECO:0000256|HAMAP-Rule:MF_03124}; Short=AGS {ECO:0000256|HAMAP-Rule:MF_03124}; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain {ECO:0000256|HAMAP-Rule:MF_03124}; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_03124};
MASKLARFGPSPAAASSFPRAFRATGLHCGIKKSPNAPDLGLLLSDSPETVAAGCFTRNR
FKAAPVHYSLQTLRDSRGQRIRAVVVNSGCANAVTGTRGLADAREMARLLDRHLHPAEHH
PAPASLVLSTGVIGQLLPIDRVRAGIAAGLAQLGPAYPDWLALAQAFMTTDTFPKLLTHS
FRLGPHEIRLAGIDKGAGMIHPSMAAPPHATLLGLIATDAAILPDALQAALTHAVDRSFN
RISVDGDMSTNDSVIALANAAAANQPISLADPHHFDQFQDELTRFALRLAKLVVRDGEGA
SKFVHIRVQGAHSERDAASIASTIATSALVKTALNGEDANWGRILCALGYSPVSHPIDPA
AVSVDIIAPNSQKQMQIRLLTNGEPEPLIDEHKAKQILSHEDLIIQLNLGHPNAHQASFY
TCDLSKEYVAINADYRS

BLAST