GenomeNet

>tr:A0A182K697_9DIPT [A0A182K697] SubName: Full=Uncharacterized protein {ECO:0000313|VectorBase:ACHR006282-PA};
MAEAEGGSEQDDVSFLRTEDMVCLSCTATGERVCLAAEGFGNRHCFLENIADKNIPPDLS
QCVFVIEQALSVRALQELVTAAGSET

BLAST