GenomeNet

>tr:A0A182TKE9_9DIPT [A0A182TKE9] SubName: Full=Uncharacterized protein {ECO:0000313|VectorBase:AMEC003922-PA};
MADIEHFLELADSAGLYVILRPGPYICAERDMGGFPSWLLHKYPDILLRTNDLKYLREVR
TWYAQLLSRVQRFLVGQGGPIIMVQVENEYGSFYACDHKYLNWLRDETERYVMGNAVLFT
NNGPGLEGCGAIEHVLSSLDFGPGTEDEINGFWTTLRKTQPKGPLVNAEYYPGWLTHWQE
PHMARTDTKPVVDSLDFMLRNKVNVNIYMFFGGTNYGFTAGANNIGAGGYAADLTSYDYD
APLDESGDPTPKYFALRDTILKYFPKPDLPVPQPTNKVQLPPLNMTRLGSLLDPSLLERL
AAQTVTSRLPLSFEALNQVSGLVLYETLLPDDIRTDPRKLIVEGVHDRGYVFVGDQFVGV
LSRENQINMLPLALDAGQTLRIAVENQGRINFGIANDGKGILGSVFVNTRQLYNWTMYGL
PLSDFKPMVHAIRHHRKHQHRFRRASQTAGTPMSLYYAIFDIEGELADTYLDPTGWGKGI
VFVNGFLLGRYWPTVGPQVTLYLSKHLLTQKNNYLAVIEYQKEFGDSIPPLKFSATPSFN

BLAST