GenomeNet

>sp:A0A183A954_9TREM [A0A183A954] RecName: Full=C2H2-type domain-containing protein {ECO:0000259|PROSITE:PS00028};
MKHIDSNTIPAKKIKRELSLTPHEEQSEDCKIELICEPCQVKLTSMTSLRQHQSGKRHMA
VVNARMQQQVFAPDKNFTDVDDRNSILSATAAHSADKPELITPMDLNDPFIRPGDNSQGS
AMFTPLMAYFCHLCNVPLPDRLSIALHIKGRRHQSLLRSLSANQNKENQLVTPPLEVNNT
VCRSNTPFYDNPSTIVPREDEMKQKFVETWVSNATPHSDSGPNVTPLSAIDPLAIKNTVR
RVCLTQILSLLGAQLETGQATALPDNQLLALISRKCTDSLYASNDLDENSSCSPLLTKLI
QSSLLMSWCQQLTSL

BLAST