GenomeNet

>tr:A0A183EHL3_9BILA [A0A183EHL3] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:GPUH_0002047901-mRNA-1};
MRTLELTAIFMMPFLLLGMFGNVHMLFATFRFSQLQNRNGILIALIAFFDFIGELHESKS
VIEILFGKSLMPRSVCFRSIFLYSISFNMACVAVLFLAIDRFIAVWSPVRYRAIGTKWFI
LLAVVAGLAYSTPIVIINFAMLDDKVIDYQFGTVEIVITGL

BLAST