GenomeNet

>tr:A0A183HJD4_9BILA [A0A183HJD4] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:OFLC_0000759501-mRNA-1};
MWEAFENPHTSTVALVFYYVTGFFIALSVLCNIIETVPCKYLVDDTTISCGELYERQFFV
LDTACVIIFTVEYLLRLFAAPDRCKFLHSIMSMIDVVAIMPYYVGLGFTNKKDVSGAFVT
LRVFGLRILGYTLKSCASELGFLVFSLAMAIIIFATIMYYAEKKVNDTRFTSIPAAFWYT
IVTVSSRSLLFFFFLLI

BLAST