GenomeNet

>tr:A0A183LH75_9TREM [A0A183LH75] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:VDO57208.1, ECO:0000313|WBParaSite:SMRZ_0000314901-mRNA-1};
MSRVYDMELLHVKSNKILRAKKQLSPEFKDASVRFTLEEYQGDESWFIIQPSYKHKQIGD
PVVIGDKVTLFACRAGCALNIKQLHSNTKQHKLISDTNHHEINNNNNNNNNNNTSWQINL
YLSYQDNLEHILKGGDIIRLFHSEAEKFLTCDAYENELHVFLRTTFRAATTTARSSKALW
EVEVIHSDCRRTGAGHWNSLFRLKHLITGLYLCPKVIKINNKSGEQGAFCKQDQDDGCIE
SFLTLSKEPTYETVFEMDSTSHYKESDGFIPNNAFVRICHTASRMWIKASEIPIDTDADK
PIMYKVTTTLRQLNLSVFDA

BLAST