GenomeNet

>tr:A0A183LQ96_9TREM [A0A183LQ96] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:VDO68758.1, ECO:0000313|WBParaSite:SMRZ_0000597201-mRNA-1};
MLATNVRIQFLWHSVYICVITSFNVGTLTDLWIGKSRSTDEIDKLSSSARRGRTANQLST
NSPPPNMPPCVFVLDQALSVRALQEMLSIQHQSSDYLSCLSTSTSQDKLAFDVGLQQNAE
TEACWWTIHPASKQRSVGEKVRIGDDLILVSVSSERYLINNKSKIDNNNNDNNAQDRVGW
RMLVSGLCSFTRSNRRK

BLAST