GenomeNet

>tr:A0A183M8X2_9TREM [A0A183M8X2] SubName: Full=Uncharacterized protein {ECO:0000313|WBParaSite:SMRZ_0001249801-mRNA-1};
QNYFRDRWNIFDFITVIGSITDVLVSELQESAFLSLGFLRLFRAARLIKLLRQGYSIRII
LWTFIQSIKALPYVCLLITMLFFIYCIVGMQV

BLAST