GenomeNet

>sp:A0A194PSN7_PAPXU [A0A194PSN7] SubName: Full=Broad-complex core protein isoform 6 {ECO:0000313|EMBL:KPI95774.1}; Flags: Fragment;
SWCGARRLSASKENLQANPHPSAVLNSTHKAVPPLRMPPPTAGGINEPQECPYCRRTFSC
YYSLKRHFQDKHEQSDTLYVCEFCHRRYRTKNSLTTHKSLQHRGSSGMLKRLLKTSALHG
ALAPAPHHLFDLAAGDQLPPGLQ

BLAST