GenomeNet

>tr:A0A195BFQ8_9HYME [A0A195BFQ8] SubName: Full=Inositol 1,4,5-trisphosphate receptor {ECO:0000313|EMBL:KYM83017.1};
MGELLGSASFLHLGDIVSLYAEGNVSGFLSTLGLVDDRCVVCPEAGDLSNPPKKFRDCLF
KICPMNRYSAQKQFWKAAKQSASSGTDAILLKRLHHAAEIEKKQNETENKKLLGTVVSYG
NVIQLLHLKSNKFLTVNKRLPALLEKNAMRVYLDANGNEGSWFYIMPFYKLRSDGDSVVV
GDKVIMEPVNAGRQGLHVAANYELSDNPGCKEVNVVNSSTSWKVTLFMEHRENQEEILKG
GDVVRLFHAEQEKFLTMDEYKKKQHVFLRTTGRTSATAATSSKALWEVEVVQHDPCRGGA
GHWNSLFRFKHLATGQYLAAEVDTDEPRESVKGKRDPPGPVYRLVSVPHSNEISSLFELD
PTTLTRGDSLVPQSSFVRLHHICTNTWVHSTSVPIDKDDEKPVMSKVGCATSKEDKEAFA
LRSVSPVEVRDLDFANDACKVLTAMNSKLEKGTISHNERRAVTSLLQDIVYFIAGSENEQ
NKSEALELVVTNVKDGPVRDRQKLLREQYILGQLFKILQAPFLESVEGEGPFLRIEELND
PRHAPYKYMFRLCYRILRLSQQDYRKNQEYIAKHFAFMQKQIGYDILAEDTITALLHNNR
KLLEKHITAAEIETFVGLVRKNMRNWQSRFLDYLSDLCISNKKAIAVTQELICKSVLSEK
NKDILIGTKMVKTQVEVEDIDEKQENAEPKITVIEEFEVVLEWNSGAKSMSLSELSRGAK
MGNVQDAAILDYYRHQLNLFSNMCLNRQYLALNNLSLHLDIDLILKCMEDETVPYELRAS
FCRLMLHLHVDRDPQEQVTPVKYARLWSEIPPKMSINDYDTNKMPDQNKEAVRTKFSSTI
MFVEDYLCNVVAKMWSFGDQEQNKLTFEVVKLARDLIYFGFYSFNDLLSLTKTLLSILDC
VSENESTDGKIPTGDIDLLYVIRASRLYKISLIIKFTQLCVVNYLADTDSEEAAEGGILR
CIGDMGAVMTNLTLGPAGQVLASSSPRPKPLMKKEYPLVMDTKLKIIEILQFILDVRLDY
RISCLLSIFKREFDETALTAAEKTGDVTLGQKAIDLDSISAQAEGIFGSSEECAALDLDG
QGGRTFLRVLLHLAMHDYPPLVSGALHLLFRHFSQRQEVLQAFKQVQLLVSDSDVESYKQ
IKADLDILRQSVEKSELWVYKSKATEEHGNKKKKSKEEEDEATAPRKIPLLSALDKQGSA
IDLDIGPPLHSDQTEEYKKIQQILMRMNKLCIQNLPGGQVKARKHEQRLLRNVGVHTVVL
DLLQVPYDTKEDVRMNELMRLAHDFLQNFCLSNQQNQVLLHKQLDLFLNPGIREAQTICS
IFQDNSVLCNEVGAKVIQHFVHCIETHGKHVQYLKFLQTIVKAENQFIRKCQEMVMQELV
QAGEDVLVFYNDRASFNHFVEMMRSERHRMDESSPLQYHVELVKLLACCTMGKNVNTEIK
CHSLLPLDDIVAVVSHPDCIPEVKEAYINFLNHCYIDTEVEMKEIYTSNHMWSLFEKSFI
VDMGLIATSTHDRQHADTALETYVTSCLMNIISTFFSSPFSDQSTTVQTRQPIFVQLLHA
AFNVSQCAWLNAGQRFNVENCIRTLSDVAKGRGIAIPTDLESQVANMFNKAAMLSRQTSK
WLQAAKQPKIERSQSQLMRLDRSIIEGLQDIVSLLEEQLKPLVQSELSLLVDILYRPELL
FPAATDARKRCENGGFIKRLIKHTEKLLEEKEEKLCVKVLRTLREMMAIDPEYGEKNRSV
GKDVFMLRTKNEGISEQTESETQSESQVGTGSNDQSENRQIIQQEPGDALRNNLLTRYFG
KSFIQNPENVDIGVSRSATITHGPGAKILSRAGRTLHDVQTHLDREGASDLVVELVIKSV
HSPSIFVEVVELGIALLEGGNPIIQRSIFNKLMGADLSQSFFKVFYDKMKDSQQEIKSTV
TVNTSDMAAKAHEDKEGKEVDKLSRKRGSGKPNGMVITDELHEELNQVAASNAQAYANMR
NGLAPGEDTANTLDDLSEKSDRNKSGNSSGGEKEEGQLSPKVLVMQPILRFLQLLCENHN
RELQNFLRNQNNKTNFNLVSETLMFLDCICGSTTGGLGLLGLYINEYNVALINQTLETLT
EYCQGPCHDNQNCIATHESNGLDIITALILNDINPLGKTRMDLVLELKNNASKLLLAIME
SRGDSENAERIMYNMNPKQLVDVACKAFHQESLDDFSDIDDSSTNAEEGVSPKEVGHNIY
ILCHQLAQHNKELAVMLKPSEQNNADPKINKALEYYASHTAQIEIVRHDRTLEQIVFPIP
EICELITMDTKIRVLNTTERDDQGSKVSDFFERTEDMFNEMKWQKKLRGQPLLFWMSSYM
SLWSNILFNCAVLINLIVAFFYPFVDSVPKLSYHLSALIWTVMLASAAIIITLPRESGIR
TFVASTILRLIFSVGPEPTLWLLGFVTITLKVIHLISIIGNQGTLTRSVEQIITNIELLY
HMSYITFCVLGLFMHPFFYSVLLFDVVYREETLLNVIKSVTRNGRSIILTAVLALILVYM
FSIIGFMFFKDDFLVPVDEEIISSIEQKIANTCSAGSKENCDATETISRYASEANVRENK
PEIVNVGGELKERTCDSLVMCIVTTLNQGLRNGGGIGDILRAPSSVEPLFVARVVYDLLF
FFIVIIIVLNLIFGVIIDTFADLRSEKQQKELILKNTCFICGLNRSAFDNKIVSFEEHIK
HEHNMWHYLYFIVLVKVKDPTEFTGPESYVYAMVKDRNLEWFPRLRAKSLAADEGEGEQV
ELRSLQSQLESTQMLVRCLSQQLTELRDQMTEQRKQKQRLGLLNSASAILHNIPT

BLAST