GenomeNet

>tr:A0A1A9HMS7_9BURK [A0A1A9HMS7] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:ANH69214.1};
MTHEHDPSQALSRALSRRSLLEMASLAGTALALGGAGLLAAREGLAAAATSAVGAASAAG
AAPAAAALPVADFLRLSVFLTGGQALDATLAGRYQVALAKRDPQFGDSARALLALIRSTQ
AGTIEQLLETPDLQDTLRAATTRIVSAWYLGIVGQDADAELISYAEALMYRPTKDVLVVP
TYGAGPDSWGDQPGVTPPVTLAATNERKTA

BLAST