GenomeNet

>tr:A0A1A9XR44_GLOFF [A0A1A9XR44] SubName: Full=Uncharacterized protein {ECO:0000313|VectorBase:GFUI018735-PA};
MENNVMTQLSEELVQRLSSGGIDLEGMSGELFGQSDLYITGNQDDSNSQIAIDNEIIMHM
DIREPLKTLQKLLEKKLNISLRDYEFWLQDAQELEPHKNLVDQCVKGEGLVQINVEIKYI
VKRINILDVLKPTEDALVAALAEQENCKTNSTSDDKQCKRNEYSQSFQGAEEKSPSKKCK
SGHESASTSKKEKPYLNWVLDSKFRKEQARLKIPDNPNDWTVAHVKYWLQWAIKQFELTN
FNMNEWSITGRQLCTLTHEEFHKKLPKDPGNVFWTHVQLLKECKFVAVVHKAAESELMEN
NAELSKNTPSLSAMPREQKIMRKSFHNTKKETEVALGSDGSITHSNYGIGSGNNGQVQLW
QFLLEILTDREHVDIIEWVGDDGEFKLTDPERVARLWGEKKNKPAMNYEKLSRALRYYYD
GDMISKVSGKRFTYKFDCDLKLLIGYSAGELSALVNERTIKGIMSGELFEQDDIYISNSQ
DDSNSQMAVDNEIIMHMDIREPLRTLQKLLEKKLGVNLNGYEFWLQDAQELEPHKNLVDQ
CVKGEGLVQINVEIKYIVKRINILDVLKPTEDALAALNIQETCETNSSSGDKQSRCNENT
EDSEEGKEAPAKKFKGDHAIASTSSKEKPCLNWVLDNKFRKEQARLNIPENPFEWTVAHV
KHWFQWAIKQFDLTNFTVNDWFITGRELCTLTHEDFRKKLPKDPGNVFWTHVQLMKECQF
VAIVHKAAENELIENKTELKKELPTDVPPAMPREQKIMRKSFHNTRKELGTSSDLNIGSD
SSLTHGNYSVGSGNNGQMQLWQFLLEILTEREHVDIIEWVGDDGEFKLTDPERVARLWGE
KKNKPTMNYEKLSRALRYYYDGDMISKVSGQRFTYKFDCDLKLLIGYSAGELSALVNEKT
FGNKSIYLEHRGNLSIQSSDK

BLAST