GenomeNet

>tr:A0A1B0CD33_LUTLO [A0A1B0CD33] RecName: Full=RPN13_C domain-containing protein {ECO:0000259|Pfam:PF16550};
MNMVGKMVHPDTRKGLVYVYQSEDGLIHFCWKDRTTGNTEDDLIIFPDDCEFKKIEQCNT
GRVYLLKFKSSSRKLFSWMQETKTDKDDEWCRRINDVINNPPTNIPSGGRGDNSDLQYML
NNMSQQQLMQLFGGVGQIGGLSSLFGGNARSSESSSARNTPSGTASGGTASATAVTPPPV
SSSVSQPAAPKKSSSGGASKTTNNGTAAESTNSGGADKTNVLLSELQSYLSEFSPSGVSG
NQRNRGTKPVELSAISTLNPWGTIAGDETCRKGLEPLLPKTAAKEPVDQQIRDTVASPQF
QQALSMFNNALQSGQLGPVFSQFNLGVEAVTAANDGDTESFLQALEKSITDKGDTKAVPE
EK

BLAST