GenomeNet

>tr:A0A1B0CQI5_LUTLO [A0A1B0CQI5] SubName: Full=Uncharacterized protein {ECO:0000313|VectorBase:LLOJ007134-PA};
MQMTLKTYILAGIVGLVVVGAVTAGIVIAVTGDDERTFRVGETDFEMDGRKFQYVAGSFH
YFRAFRDTWKDKLTVMKSAGLNVIDTYVEWATHQPEPNIYEWEEFADLPYFLDLCQELGL
YVILRPGPYICAERDNGGLPYWLFSQYPGIRVRTSDPNYLAAVSTWYEVLFAKIDPYLYG
KGGNIIMVQVENEYGVFPACDKNYMSWLKNETEKYVGDSAVLFTVDIPNEHFECGITEGA
FVTTDFGIDRIDEIESIWALVRRHQPTGPLVNSEFYPGWLTHWQEDNQRRDGDEVANVLR
RMLQDGASVNFYMYFGGTNFGFTAGANDWGIGTYEADLTSYDYDAPMDEAGNPTMKLLKI
RNVIGEFFTLPTTPVPEAKVGRAYPDIALHPVAKLFSPEGQFLIENTRVGSELQTFESLR
QMSGLVLYETNLPKIWIDPTVLTINGLADRALVYQDDLLVGCLSRGNAVNKLPLNPGSGS
RLKILVENQGRVNFNKLDDIKGILDNVTIQQRQGELEELRTWDISGYPLTNRASMNEFIQ
NVRTNTVALPNKNGVLTDGPVFFLGTLTVTADNIGDTYLDTTSWGKGVLYVNGFNLGRYW
PVVGPQITLYIPESLLRVGANTIMMLEYQKAPIPTMVSFKSYSLLDG

BLAST