GenomeNet

>tr:A0A1B7TCX4_9ASCO [A0A1B7TCX4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OBA26584.1};
MSDIIEEKIIQNDLEKAPDFYEFNDSNETTSNIIIETKKRNIFEILWYGLESVETKGISP
VTPEEQNDTSIWNTFFMWLSTTNGIAGLSTGFLAIYYGLSYSSIILIIVFFGFISCIPVA
FLATFNTGLRQLTLTRFYSGWFTTCYCFCVMNWISSAGWCSIDSSAAAEALAAINQTSGH
NIPQWVALIVLLIGSMTIVFFGYNVIHAYERFAWIATFIVYFAIIARLKITGFVKMGSDS
AKRSENIGNTFGFISCIFGFSTAWATSSADFTTYIPKTVAKWKTFLAIFSGMYLGLLITN
ILGAAICYAILNGPEEWTALYDNNGFGAAVYAVLTPSSNPNETPNAAMDGFGKFLTVILA
LSSISMTTGSCYSLSLNSAQIHPVLTKVPRHIWALIGSLVSLALSLAFAESGKFSSTFTN
IMYMVGYYVALYLGIFGCELFVFRKGRYDFFDVNDYNNFERLPVGYASFAAMCVGIIGVF
LGMNQSFWSGYISRKISDVGCELGWVLGLCFSFIAYAIFRPFEARYNQKYHPNNYLI

BLAST