GenomeNet

>tr:A0A1B7XA28_9DELT [A0A1B7XA28] RecName: Full=LPD22 domain-containing protein {ECO:0000259|Pfam:PF18834}; Flags: Fragment;
MGLLNNLDVSQIDSSVFEGLPRVDEEQEQAPVSTGGSRLADADVSQVDSSLFEGLPRSAA
PMLEYAVTRNPDTVADAQKIAKRTGMDADFVEQNYDQLSAQDRAERQQRLMETMDAGGTM
YFMRDPVNAGMAHDDLENLIRIEQESNPFRALGKTAGRAVPKVFQFYNQSMAYLSGTLDS
VEHGIGDALGTGHTGIFKRSEQFHLAQSKYINDEVLNSELLALPEHVTKSLWDNPQLLVN
PEYLVTQVGEAASSMLPMVAAYTVSGGSLAVPSVVGGLQEAASLYEDLVRDGVDQADAAT
AATSFGVVVGLLNKVGLEELTRKIPTKTIMQNLARRGAAGAAEGFTEYLEEPFQAAFSAL
AKGKDMDGVVSDVIASLKNVDVAVGAIILGSSGGVSKVAERVEDKRQAGLLATQNGVQLS
ALSDAVAKSKLAERSPEALGEFINSVFPTEASEQFVDAQQFATLFQEGIEEGQDVGTV

BLAST