GenomeNet

>tr:A0A1B8VW30_9BACI [A0A1B8VW30] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OBZ08578.1};
MESISQELVFLTEMAKGITAQFGERCEVVVHDWSKPVDSTIVVIENGHVTGREVGDPGTN
LGLEIMRGTSEGDNRHNYVTQTKDGRILRSTSMYVKNNAGSIIGALCINFDITDLMMAEK
TLQSLTASGFTPVRESFVSNVNDLLDTLLQEAQETIGKPPAAMTKEDKIKIIQLLDQKGA
FLIKKSGEKVCSYLSISKFTLYSYLEESKVADGEGGTVE

BLAST