GenomeNet

>tr:A0A1B8XYZ4_XENTR [A0A1B8XYZ4] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OCA15884.1}; Flags: Fragment;
CLFKVCPMNRYSAQKQFWKAKQAKQGNNTEAALLKKLQ

BLAST