GenomeNet

>tr:A0A1B9EKT6_9ACTN [A0A1B9EKT6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OCC08352.1};
MKRMGMIFRAKANKALDRAEDPRETLDYSYQKQLELLQKVRRGVADVATSRKRLELQLNQ
LQGQSSKLEDQGRKALALGREDLAREALSRRAALQQQVTDLETQHTTLQGEEEKLTLAAQ
RLQAKVDAFRTKKETIKATYTAAQAQTRIGEAFSGISEEMGDVGLAIQRAEDKTQQLQAR
AGAIDELLASGALDDPTGTAKDDIAAELDRISGGSDVELELQRMKAELAGGSSSSQQAIE
GGAQDGSQQSQQSSPHKFDKQ

BLAST