GenomeNet

>tr:A0A1B9IL17_9TREE [A0A1B9IL17] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OCF56173.1};
MSNNIEWENKDHYGGASAANEVNYIAQRSDVEVALGEEELAHRNPIFRKLGGLFNRGVEA
RGIERVPEDERNGKHTIGLLLLWWSVNMVVSTLPIGLLAQAYYTLTFHSAVAAIVTFTAL
GAAFTAFIATLGPKTGLRTMVITRYSVGYVGATIFSFLNILTQLGFSVTAIILGGQTLTN
VSNDKLPLEASIVIVGFLALVLCFVGYEAMHYWERYAWIVLFIFYCCMWGLAGHKGFNMG
AQQAEQDVGKSYAGDFLSFGGIVFSSASGWAPVAADFNCRLPSTIRPWKVFLLTWFGLMV
PLLFVEILSAALMTVPYYAAAFETGDAGGVLAAVFEPWGGGGKFILVIFAFSIISNCIPN
TYSAALSCQCLLPAFQKIPRALWTILVFVIYTVAAVAGREHFSEILSNFLAILGYWVAFF
VVVVFEEHYIFRYWFHRQGIDSSGPARGYDLTVYDNWRRLPIGAAGIFACCCSAGAAVVS
MAQVWYIGPLGAVFGEFGGDLGFEMSAGVTPIVYPPLRYLEYRLVGR

BLAST