GenomeNet

>tr:A0A1B9S6C8_9RHIZ [A0A1B9S6C8] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OCJ08020.1};
MPSEISQPAARLAQGVSRRTLLRGSAAIGGLAIIAAIGAPLPAAAADSDMQTFTRLSEFL
TGYQLDPVLGARYLAALVKRSQTFPADVTALQRAVTQSGATDMDAFLALPALDPAAKATA
TTIVSAWYLGVVGEPADAELITYAEALMYRPTRGILPIPTYGPGPNNWGPKPDSKI

BLAST