GenomeNet

>tr:A0A1C9VHP3_9BURK [A0A1C9VHP3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AOS80267.1};
MGSLYDELAAQPAPQPGAAQPTLYDDLVETERQERAVRGSLTATAQTTPERAAQLNYLAQ
VSGMPRAVVETDEGSAKAVAQLREIWDASADSPVLRAKLANPQFTELAKDDVGVLSQIER
GVQATTRYIMGADGRGGLAGDVKAGFHRSSAATSGAFRAVAETLAVPFDFLEQFTAIGGN
PLRRLAEGFESIAQGQTRIADRTTSGVFGVSAGVQSAVQNSKYLPLVAAGPAGAAAALTG
MVAESFGSSYQTARDRGVSQAASLIYGASDAAIEYATERIPLQRLIGDIAVDAGFVRTLG
RQIALEVPGEQIATVLQDMNEWAVLNPERSFRDYLAERPSAAAETLIATVIGTGGNVALT
QGVDRALNGYLQAQVAQTEAGQQALAVQQLLEMSAQSRLRERDPAQFREAVAEMARQAGT
ESVFVDAAVLNQLPPEIQQQLPGLAEQLADALAANSTVELKLADVLAVAPGSGVEQTLVD
NIRMAPDALTAAEATAAGQEAQTLLQQEATRVIAQAGDAVQAQAAAEQVKADVLGQLNAT
GRFGAEVNDAYATLVRDFYTVLGQRLGVSPAQAYQRYPLRVAGQGQGTAAVLEQESPEFK
AWFGDSKVVDADGKPLVVYHGTRADFDTFSPEATMSAGRVESEYGRAFYFTTDPATAESY
GESARQDGAHRVLPVYLSLRNPYIVDLTKVAVRSVYAPGHDPEFVNRLKAKGHDGIIVVD
EDFDGNLPRGTENLQAFASEVVVFEPTQIKSAIGNSGTYDPNDPNILNQSADPADDIATT
LLELGRGEGLYQLPRSQATDIAQMAAEKDLEVRPVDRNAADSTEWMLANTTPEAEGTESW
VVSTSDGRLGTITRDGNEVYINVSAVGEGGGGSAIYDLVANYALNNGLVFIGDPNGVSEA
AMRRRLENMLSSAVKYGTTDHIAPHPDQLLGNTVQGIAPLKWTPGDTLGNIRSLVEASLA
TTEAAAPLTTSEVQFDVDTQQFRQPDGTPADAAVVRSVLSFEPRVRGTGAPGQTTVQRAA
LYRALLQGPDQRRALLAAVRGQQGERGEGLGRTFYQRAKGTFDPAKLLITLNDGADLSTF
LHETGHFFLEVTADLAAAPDAPAQVQQDMAALLKWFGVPDLQTWQAMSLDEQRPHHERFA
ESFEQYLLEGRAPSRDLRSLFRKFRSFLTRVYRSLQSFTEGRDVELSDDVRQVMDRLLAT
DEQIAEAQTLAGMDRDQAATDEALEKFQARSLRDLKWAVNARAKVIAKLQAQARNLRKGI
EAEVRAEVEEVPVYKAMRWLREDTKLSIEGLESLYMGEGDRYALLDWKPLVDRRMAGKTG
VHPDVAADMFGFPSGDALVRAILAAEPLSEVVQGRTDQRMLERHGDLIDQRAIEEAATEA
IHNEARARALATELAAQREIGANRRETGQVDARGRALTVNATLEAARQFAENVAGRKAIG
DLKSAAYAHLQAERRAAKAWEAATAKGDTQAAVQAKQDQLLNHEIYRALVEAQRQVAKAE
ALFARVLKGNPERLVDRGYDPDVVAATRAILAAYGLAPRIGKTAVEYLELVEKNDPDLYA
VLKPSVEATLANAKPYDRLSVDELGALVAEVEAMQQLARRSRQMEVDGNLMDLQEAADQL
KARMEAIGVPLQMPGQDAALTPKQERTRWLQFARALGRRMEQWSEAMDGGRGAFTKLVYG
PVKAAADRYRADRAKYRKQYQQLVDRMAPALRPGEIAAPELGYTFGRGHNGIGHAELLHA
LLHTGNESNKRKLLLGRGWASENGDGSLDTSRWDAFVARMQSSGYLAKEHYDFAQGVWDL
LESTKPLAQKAHRDVFGRYFAEVTADAFETPYGAYRGGHVPAQADPRIVTDAGLRKLAEM
ENENMAFSFPTTSKGFTKARTDYNRPLILDLRTIGQHLDKVLLFSHMEPAVRDVNRLLRD
RGVSARLSKIDPAAYEGALIPWLNRSARQQVETPVVGDGRISRVLSVMRSRAGMSLMFAN
VSNTAQQITGFALAAVKVKPSKLLQATAQYIANPKKTADFVAEQSIFMRDRMRNEVAAIN
DAMDDILLKPSTYAKTQTWAQRHAYFLQAAADNVMSPIVWVGAYNQALETGQTETEAAKA
GDAAVRQTQGSTLPEDVSRIETGPAAARMFTQFVSYFNMLANTNSAELTKIARDIGMKKG
AGKALYVVTMGLLVPIWVAEAIAIAFRGGPEDEDGDGWLDDWLAAVFGMGTIKGSLAMVP
FVGQAANAGLARLNDNPADDRISLSPAVSILEGAVGAPHSVYQALAEDGSARKAVRDLAS
AISLATGLPAHAAARPLGYLAGMADDRVAPTSGLDLARGLVTGAVSPESRQ

BLAST