GenomeNet

>tr:A0A1E3BSS8_9EURO [A0A1E3BSS8] RecName: Full=Serine/threonine-protein phosphatase {ECO:0000256|RuleBase:RU004273}; EC=3.1.3.16 {ECO:0000256|RuleBase:RU004273};
MADQEVDLDSIIDRLLEVRGSRPGKQVQLLESEIRFLCTKAREIFISQPILLELEAPIKI
CGDIHGQYYDLLRLFEYGGFPPEANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFVL
RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFTMHGGLSPDLN
SMEQIRRVMRPTDIPDCGLLCDLLWSDPDKDITGWSENDRGVSFTFGPDVVSRFLQKHDM
DLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGAMMSVDESLLCSFQILKPAEK
KQKYVHGGMSFGRPITPPRKQKK

BLAST