GenomeNet

>tr:A0A1F4XGP3_9BACT [A0A1F4XGP3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OGC80333.1};
MTYQEKKFDLPELEGISKKSVEEHLGLYAGYVKNFNAISAKLVEYAKEDTEKNAHALSEL
IRRRSFEFGGMRLHELYFAQFEGGSTPPTTSSALAEALKRDYQEYFEQYFKAIGLMRGPG
WALLYWDKEAGQFLAGFSGEQHQGHFVTLPIILALDVWEHAFILDYGAQGKGKYIDAFFK
NLNWTVMEERFSLASK

BLAST