GenomeNet

>tr:A0A1F8P9L0_9CHLR [A0A1F8P9L0] SubName: Full=Chromosomal replication initiator protein DnaA {ECO:0000313|EMBL:OGO19808.1}; Flags: Fragment;
MELTKTRTPQEIWQTALGELQVQVSKPNFRTWFNKTVGLSSQENQFVIGVPNTFAAEYLE
KNQRSLIEKTLAGLTSPGVSAVFQVNGKNHATTVARTETPSPLPEVAPSFTRLNRNYTFE
TFIEGDCNRLARAASLAVAQNPGHSYNPLFIYAGSGLGKTHLLHAIGQAVEARHINVICT
SAEEFTNEFVTALREKTTEEFRNKYRSIGMLLIDDIQFISGKEQTEESFFHTFNELHNTN
RQIVITSDCPPGAMPLLEKRLRSRFEWGLIVDIKPPDFQTRLAILESKTRQRGVNIARDV
IELVARQEHHNIRTLEGSLNRVIAYARLLKTA

BLAST