GenomeNet

>tr:A0A1F8RJ72_9CHLR [A0A1F8RJ72] RecName: Full=Arginine biosynthesis bifunctional protein ArgJ {ECO:0000256|HAMAP-Rule:MF_01106}; Includes: RecName: Full=Glutamate N-acetyltransferase {ECO:0000256|HAMAP-Rule:MF_01106}; EC=2.3.1.35 {ECO:0000256|HAMAP-Rule:MF_01106}; AltName: Full=Ornithine acetyltransferase {ECO:0000256|HAMAP-Rule:MF_01106}; Short=OATase {ECO:0000256|HAMAP-Rule:MF_01106}; AltName: Full=Ornithine transacetylase {ECO:0000256|HAMAP-Rule:MF_01106}; Includes: RecName: Full=Amino-acid acetyltransferase {ECO:0000256|HAMAP-Rule:MF_01106}; EC=2.3.1.1 {ECO:0000256|HAMAP-Rule:MF_01106}; AltName: Full=N-acetylglutamate synthase {ECO:0000256|HAMAP-Rule:MF_01106}; Short=AGSase {ECO:0000256|HAMAP-Rule:MF_01106}; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ alpha chain {ECO:0000256|HAMAP-Rule:MF_01106}; Contains: RecName: Full=Arginine biosynthesis bifunctional protein ArgJ beta chain {ECO:0000256|HAMAP-Rule:MF_01106};
MSETIEVVAEGGVTSARGFVAGAVRARMREDWDKLDVALLYSETPCTAAGVYTQCNVVAA
PVVITRKHLADGKARAVIANSGCANAATGERGTRDAVEMAQLAAARLGLDPHEVVVASTG
VIGIFLPMERMRHAIEAVELSAGGGLAFAQGIMTTDTRPKQSAVRFGEYTLGGACKGAGM
IHPNMATMLAYVTTDAPVAAPFLSRTLKDAVAVSFNMIDVDSDTSTNDMLVVLANGVAGG
EEIAEGHPMASAFASALTHVCTELAKAIVADAEGGSKVIEATVVGAASAEDARLAAREVV
RSLAVKTAVYGHDPNWGRVLAAVGNSGCRMEEAKTGLWLVDRDGHELCLLENGSPQPLAA
GAAKPHFEALEVRFRVDLGLGKEEATAWGSDLTEEYVRLNSLYTT

BLAST