GenomeNet

>tr:A0A1F8RVW1_9CHLR [A0A1F8RVW1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OGO51797.1}; Flags: Fragment;
MAASELGRDASAIHMAAEGSWPVVPKERTWGAIGLFGVTLSAGIAAWSYTIGGAVSWYLP
AALGTIAMIAGALVGMYFVTVAALPVSVKYGIDTIAASKPQYGSRGASFSIFVQYASIIG
WNCILIIIFGRAAANVLAAGGLLTADQTGVVSIAISLVTIAIAYWMVIGGADSIRNNSVW
IAAAVAIAGAIVLFQLISQTGWDKITAGEPAFATGSLHLDYTLGFEILVATVLSWWPYMG
GIMRMGKSVRQALLPSMICLGLMTGLIGLIGLYAGLATGEPDPSISFVQVTGLWMGLVAV
LFIGLANVGTAIVGVYATMIGLKQIPALQYRLSWRWTAAITLGPVAIIAAFFSGVFMDNV
LTFMYGLGVVFAPICGIQIVDYYLFRRQKLHVPSLYDYSSKGRYHFWGGFNPAAFVATAA
GMVFYWFLLDPVTYESRFMIGDTVVFQWLSASIPTVVL

BLAST