GenomeNet

>tr:A0A1G0ZKF5_9BACT [A0A1G0ZKF5] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:OGV58642.1};
MSLTFNRRLAKFAAIPAFAVALFISCAGFAQENLIRNADFKTDANNDGVPDGWSAQKGIS
YPAENGRKYLKIEGGQASTGIKVPIDPQWKSLKLSFKARYKDVEVGDQTWKTARLAMNFS
DKDGKKVGDWPEVWGETGTSDGWITFERQYKIPEGAAFLGLNPANFGKSGTVEFDDIKLT
VGRAKGSLYVDPADARLPEKNIVENGNFEADSNKDGTPDKWDKREGISYPSENGKRWLKI
DGGGKSVNRKLELEGGWGVLKMSFKARVADVVPGAEGWQNARMAMNFADEGGKKVGEWPD
VFNWNGSTNGWVDCEREYKIPPGAEFLVLNPANHGKSGSVEFSDIVIKVVSMNYKGDMPL
PEGADKEPWDIAKAWKKTSSTQEKICINGLWRVIPEVAEKTVPPADGAGWGWFKVPGVWP
TQDWTVGDATQKFLLPPMSEDATSGKMIEQVWYKRDIFLPDAWAGRKIYLDFTLLQTNAR
IFLDGKDVGEIWFPGGRFDLTDFVEAGKKYNLTILVTARPLEAETKVFMAPDRIMSNKAS
VKLKGIAGDLFLCSEPKADAIQDLHVITSVAEGKISFKTKIGSPAAGEHVLSAKVLDRSG
KEVKTFKSGKIPFTPDKSEYVFGGEWKDALLWDTNTPQNIYTAIVSIEDANGRKLDELLP
VKFGFREFKIVGKDFYLNGKLIRLRALWVNSISDFADKCDYASGMNLSRRMKDYGFNFFI
TGNYDFEPGDVSYMDAIFDAADDAGMLASFSLPHIKNFKWLNSEAAVKNYGELTAWLISR
MKNHPSIIMYAMNHNANGYHGDQNPLKMDGVYEPEKVPSELAKSKKGSYIEKREMSEKAA
SISKSYDPTRPVYHHQCGNLGDLYTVNCYLNWAPRQERSEWMEHWNRNGVKPFFFVEWGL
PHISSWSSYRGPEFIWRCVAFQSVWDSEFASSILGEGAYEMIPAKIKLIDIEEKNYATGK
PFHWGGVLTPTLSNMEKNHREIMAYYASDNWRSHRAWGVSAMLPWDQSELWERVNPTPDK
PNEAKYKDLQKPGIVPDVSHRGGQFIHDPGDIKDFKPSSIGSVFLRNNREFLGFIGGTPK
FTDKSHNFAAGENVSKQLVMINDSRENRKCSYSWKIDGAGLKGSGESDLKPGEIKFVPVD
FKMPAGREKLELAVEFDFAGGRRLSEPSAKNEIQSDTFSLDLVKADTAKVATKSKVMLFD
PEGITAKSLDAYGVAYSKINSPAEVAKGDILVIGRNALSKNEPLYDLNKVADGLKVVVFE
QDDTSFFNKIGFRVNVQGIRNVFARVKTHPVLEGVTDDMLRDWRGSATLMPPNLEVAGFE
EKDPQWEWCGFLNTRVWRCGTRGNICSVMIEKPERGSWLPILDCGFDMQYSPLLEYSQGA
GKIIFCQLDVSGRTENDPVGANIVRNIFKYMDAVKAGESRKVLYAGDAVGSKLLEDLGVN
FAALKDGEKPSGDSLLVVSPGAKLANMKDAVASGANLLALGLDEKAVNELLPDTAKMGKF
SGYSSLVKDLAAPEFTGISNSELHWRGKLDFDGFADKGDTSCDMLKSIKIGKGTAVFCQL
APWNIDYVKKPYQRTSFRRNVFMVSRLLANLGASSESPLLANFARMPAKSKLKLAEGWIG
EADKDNSGDSKGWSKEEFDDSAWRPIQVPGMFDMLRKDLDGYDGYFWYRLKFKTPEGFDP
NAELVLKMGAIDDESWIWLNGKFLGEVTKTSNPKDYYVAPRTYTLKPGMLKKDGVNTLVV
KVNDTYLNGGIKDMPFLNKNGAPWLNTYYLQEPIADDDPYRYYRW

BLAST