GenomeNet

>tr:A0A1G1JQV2_9BACT [A0A1G1JQV2] RecName: Full=SLBB domain-containing protein {ECO:0000259|Pfam:PF10531};
MKRFSPQHALLVLLAFASMGYADSSQNYRIGVGDLLQIEVYDELDLTKEVRVLTDEHISF
PLIGSIKAAGLTVVELQKQITHLLARKYLVDPQVTVFVKEYSRVFVFGEVKSPGSLPIYG
NMTVFEAITLAGGFTEIANQSKVKVVREERGMEQVYEADVERITKKGDTSQDIKLKANDR
VIVSRGFF

BLAST