GenomeNet

>tr:A0A1G4X0Y4_9FIRM [A0A1G4X0Y4] SubName: Full=DNA binding domain-containing protein, excisionase family {ECO:0000313|EMBL:SCX33491.1};
MTAAEAAIFQKRLIKMIEYITTKEASEKWNISRRRVNTLCQEGKIPNVARVGNMWLIPSD
STKPLDGRSFKIPNNEVRRFCVSIEEIICEDFVVTADSIEKAIQVAVEKYQKEEFVLSPG
NIESKQIMVYDKGNDTFTDWIEF

BLAST