GenomeNet

>tr:A0A1G8K0T2_9RHOB [A0A1G8K0T2] RecName: Full=Urease subunit alpha {ECO:0000256|HAMAP-Rule:MF_01953}; EC=3.5.1.5 {ECO:0000256|HAMAP-Rule:MF_01953}; AltName: Full=Urea amidohydrolase subunit alpha {ECO:0000256|HAMAP-Rule:MF_01953};
MPRPINRADYAAMFGPTVGDRLRLADTDLIIEVERDLTAEAVGAALTGGQGSNALAYGEE
VKFGGGKVIRDGMGQSQATRAQGAVDTVITNALIVDHWGIVKADVGLKDGRIAAIGKAGN
PDTQPGVDIVVGPGTEAIAGEGRILTAGGFDSHIHFICPQQIEDALHSGLTTMLGGGTGP
AHGTLATTCTPGPWHIGRMLQAADAFPMNLAFAGKGNASLPAALEEQIRGGACALKLHED
WGTTPAAIDCCLGVADAWDVQVMIHTDTLNESGFVENTVKAMKGRTIHAFHTEGAGGGHA
PDIIKICGEQHVLPSSTNPTRPFTVNTIEEHLDMLMVCHHLDKSIPEDVAFAESRIRRET
IAAEDILHDMGAFSIIASDSQAMGRVGEVIIRTWQTADKMKKQRGRLPEETGDNDNFRVR
RYVAKYTINPAIAHGISEHIGSIEVGKRADLVLWSPAFFGVKPEMVLMGGSIVMAQMGDP
NASIPTPQPVYSRPMFGAYGRSVEHSAVTFVSAAAQADGIGARLGLAKQTLAVSNTRGIG
KRDLILNDACPEIEVHQETYEVRADGELLTCQPAEVLPMAQRYFLF

BLAST