GenomeNet

>tr:A0A1H1AMB2_9GAMM [A0A1H1AMB2] SubName: Full=Polysaccharide export outer membrane protein {ECO:0000313|EMBL:SDQ40774.1};
MLRSIAGLTAVCLSLLLTACASSGGSAKAPPAVQATATAVDSYKIGVDDIVQVSVWRNPE
LGITVPVRPDGMISVPLVGDVAAGGHTPAEVAKDIQTKLASFVRDPQVAVILTDLRSHEY
LSRVRVTGAVRQPISIPYRPGMTVLDAVLAAGGVTEFAAGDRSELYRKSGEGTETYAVRL
DKILNRGDLSTNFPVSPGDVITIPERTF

BLAST