GenomeNet

>tr:A0A1H1AWZ1_9EURY [A0A1H1AWZ1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:SDQ43676.1};
MGLGGTAKKLQKVAEMAEDVYARLNDLRDQIHEMRETVGETKDRVDSLETESAEQRAILE
AIAEEQGIDVETVTATAHIREAEADETATDADATDAGATDADETDAGTADPEPADEA

BLAST