GenomeNet

>tr:A0A1H3W276_9FLAO [A0A1H3W276] SubName: Full=Polysaccharide export outer membrane protein {ECO:0000313|EMBL:SDZ81153.1};
MKNYLYYILTIVVFASCAPKKNIIYYQDSDSVELKSVEEIYKHPKIQINDILHITVSALN
PESVIPFTSEISKNQTQSIRMELLKLQGYLVNSDGEINYPQLGKIDVKGKTTQEITSLIQ
EKLSKFIIMPRVSVRIINYKFTIEGEVKKPGTYESSEELLTLPQALGMAGDLTINGKRNN
IKIIREVNGSREVKTIDMTKTGWLNSPYYYVYPNDIVYVEPNSPKVKQAGFIGNTATLLS
ALSVILSAIVIITR

BLAST