GenomeNet

>tr:A0A1H4G5J1_9BACI [A0A1H4G5J1] RecName: Full=Ferrous iron transport protein B {ECO:0000256|RuleBase:RU362098};
MQIALLGNPNTGKTSLFNSLTGSYQYVGNWSGVTVEKKVGSLRNGRDDLIDLPGIYSLNP
LSKDEAVVSNFLLHESFEEMLNIVDASQLRRNLNLTIPLLEFGKPMVIGLNMTDVAKLRG
IRVQEDYLSEELGVPVVPIIARSGTGIEFLEDELYEENAWRKPFKLDYGMAVENAIAALV
KLMPKSFSAKRWLAIQFLEENRAVENFIYSVANESLLCKIRSELEEKLSKPPAIDIQDTR
NKYIEHVIERVTIREKISRVTLTDKIDALATHKYLGLPIFLLLMYVMFMLTFNWLGFPLS
DQLDRLFSGPLTSGLEELLGMIGASSFIHALVLDGIVAGVGGVLVFVPQIFILFFFISLL
EDSGYMARVATVMDRVMQAIGLNGKSFIPMIIGFGCNVPGVMAARTVEQPKERLMTILLT
PLMSCSARLPVYALFVGAFFTQNQAFVVLSIYLLGIILALLLAKLFSKTIFKQEESFFVM
ELPPYRLPQWTSLWRSTWDKGKGFVRKAGTFIFAGSVFIWLLTYAGPGGLDVPMDESFLA
LIGSSIAPLLAPIGFDNWQSSAALLTGFLAKEVVVSTMSIIYTVPDGTLQEVLATSFTPL
AAYSFMVFILLYIPCLATIAAINKETGSRKWTLFSMAYALIIAYAVSFSIYQIGQWFIG

BLAST