GenomeNet

>tr:A0A1H5NJM0_9ACTN [A0A1H5NJM0] SubName: Full=Beta-galactosidase, domain 3 {ECO:0000313|EMBL:SEF01071.1};
MRGSRNGSEGARPGRRRWWRAVLATAATIALAAGMTAPATAVAQDIGEQTPAVGPDAADT
PQAHTVTLDGYSFLVDGKRTYLWSGEFHYFRLPSQDLWRDIFQKMKAAGFNSTSLYFDWG
YHSPKPGVYDFTGVRDVDKLLDMAQEAGLYVIARPAPYINAEVDGGGLPGWLSTKAGNNR
SDDPQFLKYADEWLTQIDRIIARHQLTNGTGSVIAYQVENEYYNGSAAGRSYMQHLEDKA
RADGITVPLTGNNNGTFNFGTGALDVDGPDSYPQGFNCSNPAKWNGVPDISYDHPAGKPL
YSPEFQGGAFDPWGGPGYDKCAQLINDQFANVFYKQNIAVGATAQSFYMTYGGTNWGWLG
MPQNYTSYDYGAAIRETRQLDPKYYEDKLIGYFTQSVAPLTKTEAIRTTPPDDSAVVDTA
RMNPDTKTQFHVLRHGNSTSTAVDKTHISLDFNAVPSADTTYTWDDPDSALQYAGSWSHV
ADTSYTGGDYKHTESFSKTAGDSLTVPFDGTAIRWIGSKTNNHGNADVYLDGTKVATVDD
SGSESQAVLFQKTGLTPGAHTLKIVVAGSHSSGSTDNYVAIDAIDVPTSDSAAEPTYPVV
PQQPGTAITLDGRDSHVIVANYRLGDAQLQYSTSEIMTDATIGNRDVAVLYGDEDSDGET
VLRYATEPTVTANGGAVATSWDPSTGDLRLNYTHKGLIRISISGDGKRPLLLLVGDKATA
ETFWRQDTASGPVLVRGTHLLRTATSLRGGRTVALTGDNADDKNIEVFTSAAQVTWNGRV
LGTHATDTGSLTGKIPVAAPVNLPALTNWKHAEESPEAASGFDDTSWQVADKATTNSVSG
VNSLPVLYADDYGFHTGNTWYRGRFRATGKETGIHLVSDSGGDAQAFSVWLNGTFLGSST
TGSGDFAFPADALKSQGDNVISVLTVNMGHEEDYNSTNGNKAARGLTSASLVGAPLTSVT
WRLQGVRGGEDLQDTVRGPLSTGGLYGERAGWSLPGYPDADWNRVTLPTTDTTPGVSWYR
TDAKLDLPHGQDTSVGLTFTDAPARKYRATIFVNGWQVGNYVNYLGPQHTFPVPNGILNP
NGHNSIAIAVWNLDGRTGGLGQVSLTDYGSYASSLRVAQNDSPRYDARTYAMPKRPGADV
TLDVPDTAQPGQAFTARTTVRVPKDGRPASGLTASLAAPDGWSVSATSPESVERLRPGTS
ATFTWQVRPPAGTLPSASALTSTVHYRRNGRQAVGGDERIVRGIPPAPPAGQSDVSALPF
LSSTNGWGPVERDTSVGEQAAGDGRPITIAGVGYAKGLGTNSVSDVELYLAGQCSRLTAY
VGVDDETNGAGTVTFSVIADGKTLVTTPTIHGKQAAVPIDVDVSGAQVLDLKVGDAGDGN
GNDHGDWGSPTLTCE

BLAST