GenomeNet

>tr:A0A1H9N5I3_9PROT [A0A1H9N5I3] RecName: Full=Cell division protein FtsL {ECO:0000256|HAMAP-Rule:MF_00910};
MILFRFNLILIALLVICALGVVTIQHEARKLNMAWENERKTARKLQIEWGKLQLEQSTLI
ARRQIEYAAREQLNMEIPSANSVQIISAKKADESRWVVLDNAKSY

BLAST