GenomeNet

>tr:A0A1I0R2E4_9FIRM [A0A1I0R2E4] RecName: Full=Ferrous iron transport protein B {ECO:0000256|RuleBase:RU362098};
MSSSNEIINVAFIGNPNCGKTSLFNDYTGAKLKVANWPGVTVEKKEGSYKFRDKEYKLVD
LPGIYSLTSYTMEEKLSRQYILEDEVDVIIDVADASSLERNLYLTLQLIELGKPVVLALN
MMDIVEERGMEIDIHRLPEMLGIPVIPVSARKKTGLEVLMHAVAHHKNKSSLEKLEHHHD
ESSSTKHKHNHHYECVMVYSDDIEDMIDVVTERLQVKYPDMINFRWHAIKMLEMDDEITE
RYPIGLADIVSRSYELDIINQKYDFIEEVIQECLVNKDKKAHVTDIIDAIFTNRILGLPI
FLAIMALVFFLTFTIGDSLKGVFEIFLKWFSGSTRGFLGSVGTNEVLISLVVDGIIAGVG
GILTFLPNIFILFLALAFLEDSGYMSRVAYVMDSIMGKLGLSGRAFIPMMLGFGCSVPAI
MASRSLEDPKDRMKTILVTPFMSCSAKLPIYVIFSQMFFPKHALLVTYSMYLIGLMVAVM
VALILNTFDKKKSLHSLLIELPEYKAPNARSIAIYVWGKVKDYLSKAGTTIFFASIIIWV
ILNFGTHGMVTDMSQSFGASIGKALSPIFAPTGLNQWKIVVALIAGIAAKEIVVSSMGIL
YGIGNINSVAGMAGMSAGLAATGFGALNAYSLMVFCLLYVPCAATIATIKRETHSWKWTI
FAVCFQLGVAYFVSTLIYQVGKLFL

BLAST