GenomeNet

>tr:A0A1I1Z657_9BACT [A0A1I1Z657] SubName: Full=Tetratricopeptide repeat-containing protein {ECO:0000313|EMBL:SFE27221.1};
MKAFNLFILYRLPLGIVLLLGGVALGFTVGWWEATIPLLLAVVCLVTHFMFGPMRIVQEA
VEAGNIDVAMNLMNKVAFPKLLYKPIRSVYYFMQSNLAMYNKDLDKAEATIRQSIASGSP
MKEYEGMQYFQLGTISYQKNDLKTADQNLRKAVKMGLPDKENTAAALLTLASIAMSRRDF
KSAKDYFRRAKAQKPTTAQIVSQIKEMDKYISRMPG

BLAST