GenomeNet

>sp:A0A1I4EBF3_9RHOB [A0A1I4EBF3] SubName: Full=Acetolactate synthase, small subunit {ECO:0000313|EMBL:SFL03065.1};
MSALNIKKGASSHSAYDLRSTFGDTIERHTLAVIVENEPGVLARVIGLFAGRGYNIESLT
VAEIDHTGHLSRITIVTTGTPQVIVQIKAQLGRIVPVHEVHDLTVDGPSVERELALLKVA
GQGEARVEALRLADIFRASVVDSTLQSFVFEITGTPEKIDAFSELMRPLGLQEVARTGVA
ALARGKESHV

BLAST